missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WDSOF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Spécification
| Antigène | WDSOF1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18143379
|
Novus Biologicals
NBP2-47580 |
0.1 mL |
624.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18660316
|
Novus Biologicals
NBP2-47580-25ul |
25 μL |
280.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
WDSOF1 Polyclonal specifically detects WDSOF1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spécification
| WDSOF1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DDB1 and CUL4 associated factor 13, DKFZp564O0463, GM83, HSPC064, MGC126859, MGC138247, WD repeat and SOF domain-containing protein 1, WD repeats and SOF1 domain containing, WDSOF1 | |
| DCAF13 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 25879 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: GIGTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit